PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21850A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 327aa    MW: 35785.4 Da    PI: 5.0775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21850AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171158148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT +Ed+ lv++++ +G g+W++ a+  g++Rt+k+c++rw++yl
  Oropetium_20150105_21850A 11 RGPWTVDEDLALVNYITDHGEGRWNSLAQAAGLKRTGKSCRLRWLNYL 58
                               89********************************************97 PP

2Myb_DNA-binding57.24e-1864107146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Oropetium_20150105_21850A  64 RGNFTADEQLLILDLHSRYGNR-WSKIAQHLP-GRTDNEIKNYWRT 107
                                89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.242658IPR017930Myb domain
SuperFamilySSF466899.39E-318105IPR009057Homeodomain-like
SMARTSM007175.2E-141060IPR001005SANT/Myb domain
PfamPF002493.4E-151158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-221265IPR009057Homeodomain-like
CDDcd001671.94E-101358No hitNo description
PROSITE profilePS5129424.54859113IPR017930Myb domain
SMARTSM007171.6E-1663111IPR001005SANT/Myb domain
PfamPF002491.7E-1664107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2566112IPR009057Homeodomain-like
CDDcd001672.16E-1266107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
EEERLAVELR RGPWTVDEDL ALVNYITDHG EGRWNSLAQA AGLKRTGKSC RLRWLNYLRP  60
DVKRGNFTAD EQLLILDLHS RYGNRWSKIA QHLPGRTDNE IKNYWRTRVQ KHAKQLNCDA  120
NSKRFKDAMR YLWMPHPHHL VVNNDCGGLL HHSAVAEQDV YYYDDTAIAG DAVVCAAGPS  180
GMGGVTSGGA SSSDSFATTT TSESYDVAAA AAFPPKKWAA AGYDDDGGGP GLYADASAPG  240
EVLVVNGGAA GDCWVQETNQ QGLCWRRPAD DEHGKAPQVN GGGGDGNGQQ QQQFEVDPEL  300
SGWVQSFSEG ITENSFWTLE DIWKMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-26511121126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0697441e-142BT069744.1 Zea mays full-length cDNA clone ZM_BFb0226N11 mRNA, complete cds.
GenBankKJ7276381e-142KJ727638.1 Zea mays clone pUT5565 MYB transcription factor (MYB100) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962755.11e-109PREDICTED: transcription factor MYB108-like
TrEMBLK3Z8G11e-109K3Z8G1_SETIT; Uncharacterized protein
STRINGSi022831m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-73myb domain protein 112